PDB entry 1wdb

View 1wdb on RCSB PDB site
Description: nmr solution structure of bovine cytochrome b5, minimized average structure
Deposited on 1996-02-02, released 1997-01-11
The last revision prior to the SCOP 1.59 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1wdb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wdb_ (-)
    skavkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfed
    vghstdarelsktfiigelhpddr