Lineage for d5x2mh_ (5x2m H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744515Domain d5x2mh_: 5x2m H: [410684]
    Other proteins in same PDB: d5x2ma_, d5x2mb_, d5x2mc_, d5x2md1, d5x2mk1, d5x2mk2, d5x2ml1, d5x2ml2
    automated match to d6shgh_
    complexed with ca, cl, gln, na, nag

Details for d5x2mh_

PDB Entry: 5x2m (more details), 2.21 Å

PDB Description: crystal structure of the medaka fish taste receptor t1r2a-t1r3 ligand binding domains in complex with l-glutamine
PDB Compounds: (H:) Fab16A Heavy chain

SCOPe Domain Sequences for d5x2mh_:

Sequence, based on SEQRES records: (download)

>d5x2mh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvkpgasmkisckasgysftgysmnwvkqshgknlewiglinpyngdtty
kqkfkgkatltvdrssstaymellrltsedsavyycarsgrgapttttawftywgqgtlv
tvsaakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpav
lqsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d5x2mh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgpelvkpgasmkisckasgysftgysmnwvkqshgknlewiglinpyngdtty
kqkfkgkatltvdrssstaymellrltsedsavyycarsgrgapttttawftywgqgtlv
tvsaakttppsvyplaptnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d5x2mh_:

Click to download the PDB-style file with coordinates for d5x2mh_.
(The format of our PDB-style files is described here.)

Timeline for d5x2mh_:

  • d5x2mh_ is new in SCOPe 2.08-stable