SCOP 1.63: Domain d1hvyc_: 1hvy C:

Lineage for d1hvyc_ (1hvy C:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family)

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55840] (5 PDB entries)

8. Domain d1hvyc_: 1hvy C: [41051]

Details for d1hvyc_

PDB Entry: 1hvy, 1.9 Å

PDB Description: human thymidylate synthase complexed with dump and raltitrexed, an antifolate drug, is in the closed conformation

SCOP Domain Sequences for d1hvyc_:

Sequence; same for both SEQRES and ATOM records:

>d1hvyc_ d.117.1.1 (C:) Thymidylate synthase {Human (Homo sapiens)}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptikmemav

Timeline for d1hvyc_:

• d1hvyc_ first appeared (with stable ids) in SCOP 1.55
  
• d1hvyc_ appears in SCOP 1.61
  
• d1hvyc_ appears in SCOP 1.65
  
• d1hvyc_ appears in the current release, SCOPe 2.08