SCOP 1.63: Domain d1bo8a_: 1bo8 A:

Lineage for d1bo8a_ (1bo8 A:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family)

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Lactobacillus casei [TaxId:1582] [55835] (39 PDB entries)

8. Domain d1bo8a_: 1bo8 A: [40994]
   complexed with dum, pot; mutant

Details for d1bo8a_

PDB Entry: 1bo8, 2.4 Å

PDB Description: thymidylate synthase r178t mutant

SCOP Domain Sequences for d1bo8a_:

Sequence; same for both SEQRES and ATOM records:

>d1bo8a_ d.117.1.1 (A:) Thymidylate synthase {Lactobacillus casei}
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpystrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav

Timeline for d1bo8a_:

• d1bo8a_ first appeared (with stable ids) in SCOP 1.55
  
• d1bo8a_ appears in SCOP 1.61
  
• d1bo8a_ appears in SCOP 1.65
  
• d1bo8a_ appears in the current release, SCOPe 2.08