Lineage for d1ev8a_ (1ev8 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261486Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 261487Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 261488Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 261500Protein Thymidylate synthase [55833] (7 species)
  7. 261515Species Escherichia coli [TaxId:562] [55834] (48 PDB entries)
  8. 261590Domain d1ev8a_: 1ev8 A: [40989]
    mutant

Details for d1ev8a_

PDB Entry: 1ev8 (more details), 2.6 Å

PDB Description: crystal structure analysis of cys167 mutant of escherichia coli

SCOP Domain Sequences for d1ev8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev8a_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrccdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOP Domain Coordinates for d1ev8a_:

Click to download the PDB-style file with coordinates for d1ev8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ev8a_: