Lineage for d1tlsa_ (1tls A:)
- Root: SCOP 1.63
Class d: Alpha and beta proteins (a+b) [53931] (224 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Escherichia coli [TaxId:562] [55834] (48 PDB entries) 
Domain d1tlsa_: 1tls A: [40982]
Details for d1tlsa_
PDB Entry: 1tls (more details), 2.6 Å
PDB Description: thymidylate synthase ternary complex with fdump and methylenetetrahydrofolate
SCOP Domain Sequences for d1tlsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tlsa_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOP Domain Coordinates for d1tlsa_:
Click to download the PDB-style file with coordinates for d1tlsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tlsa_:
- d1tlsa_ first appeared (with stable ids) in SCOP 1.55
- d1tlsa_ appears in SCOP 1.61
- d1tlsa_ appears in SCOP 1.65
- d1tlsa_ appears in the current release, SCOPe 2.08, called d1tlsa1
View in 3D
