Lineage for d1kcea_ (1kce A:)
- Root: SCOP 1.63
Class d: Alpha and beta proteins (a+b) [53931] (224 folds) 
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
contains large mixed beta-sheetSuperfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) 
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins) Protein Thymidylate synthase [55833] (7 species) 
Species Escherichia coli [TaxId:562] [55834] (48 PDB entries) 
Domain d1kcea_: 1kce A: [40944]
Details for d1kcea_
PDB Entry: 1kce (more details), 2 Å
PDB Description: e. coli thymidylate synthase mutant e58q in complex with cb3717 and 2'-deoxyuridine 5'-monophosphate (dump)
SCOP Domain Sequences for d1kcea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcea_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai
SCOP Domain Coordinates for d1kcea_:
Click to download the PDB-style file with coordinates for d1kcea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kcea_:
- d1kcea_ first appeared (with stable ids) in SCOP 1.55
- d1kcea_ appears in SCOP 1.61
- d1kcea_ appears in SCOP 1.65
- d1kcea_ appears in the current release, SCOPe 2.08, called d1kcea1
View in 3D
