Lineage for d4jy6d_ (4jy6 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756122Domain d4jy6d_: 4jy6 D: [409089]
    automated match to d6shgh_
    complexed with gol, zn

Details for d4jy6d_

PDB Entry: 4jy6 (more details), 2.5 Å

PDB Description: Crystal structure of human Fab PGT123, a broadly reactive and potent HIV-1 neutralizing antibody
PDB Compounds: (D:) PGT123 heavy chain

SCOPe Domain Sequences for d4jy6d_:

Sequence, based on SEQRES records: (download)

>d4jy6d_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlhlqesgpglvkppetlsltcsvsgasindaywswirqspgkrpewvgyvhhsgdtnyn
pslkrrvtfsldtaknevslklvdltaadsatyfcaralhgkriygivalgelftyfymd
vwgkgtavtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalts
gvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepks

Sequence, based on observed residues (ATOM records): (download)

>d4jy6d_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlhlqesgpglvkppetlsltcsvsgasindaywswirqspgkrpewvgyvhhsgdtnyn
pslkrrvtfsldtaknevslklvdltaadsatyfcaralhgkriygivalgelftyfymd
vwgkgtavtvssastkgpsvfplapstsggtaalgclvkdyfpepvtvswnsgaltsgvh
tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepks

SCOPe Domain Coordinates for d4jy6d_:

Click to download the PDB-style file with coordinates for d4jy6d_.
(The format of our PDB-style files is described here.)

Timeline for d4jy6d_:

  • d4jy6d_ is new in SCOPe 2.08-stable