SCOPe 2.08: Domain d4jy6a2: 4jy6 A:112-213

Lineage for d4jy6a2 (4jy6 A:112-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4jy6a2: 4jy6 A:112-213 [224072]
   automated match to d1etza2
   complexed with gol, zn

Details for d4jy6a2

PDB Entry: 4jy6, 2.5 Å

PDB Description: Crystal structure of human Fab PGT123, a broadly reactive and potent HIV-1 neutralizing antibody

PDB Compounds: (A:) PGT123 light chain

SCOPe Domain Sequences for d4jy6a2:

Sequence; same for both SEQRES and ATOM records:

>d4jy6a2 b.1.1.0 (A:112-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapt

Timeline for d4jy6a2:

• d4jy6a2 first appeared in SCOPe 2.03
  
• d4jy6a2 appears in SCOPe 2.07