![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) ![]() alpha-beta(2)-alpha-beta(5)-alpha |
![]() | Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
![]() | Protein Profilin (actin-binding protein) [55772] (8 species) |
![]() | Species Rubber tree (Hevea brasiliensis), hevb8 [TaxId:3981] [55780] (1 PDB entry) |
![]() | Domain d1g5ub_: 1g5u B: [40894] complexed with na |
PDB Entry: 1g5u (more details), 3.1 Å
SCOPe Domain Sequences for d1g5ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5ub_ d.110.1.1 (B:) Profilin (actin-binding protein) {Rubber tree (Hevea brasiliensis), hevb8 [TaxId: 3981]} swqtyvddhlmcdidghrltaaaiighdgsvwaqsssfpqfksdevaavmkdfdepgsla ptglhlggtkymviqgepgavirgkkgsggitvkrtgqaliigiydepltpgqcnmiver lgdylldqgl
Timeline for d1g5ub_: