Lineage for d1g5ub_ (1g5u B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427772Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1427773Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 1427774Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 1427775Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 1427810Species Rubber tree (Hevea brasiliensis), hevb8 [TaxId:3981] [55780] (1 PDB entry)
  8. 1427812Domain d1g5ub_: 1g5u B: [40894]
    complexed with na

Details for d1g5ub_

PDB Entry: 1g5u (more details), 3.1 Å

PDB Description: latex profilin hevb8
PDB Compounds: (B:) Profilin

SCOPe Domain Sequences for d1g5ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5ub_ d.110.1.1 (B:) Profilin (actin-binding protein) {Rubber tree (Hevea brasiliensis), hevb8 [TaxId: 3981]}
swqtyvddhlmcdidghrltaaaiighdgsvwaqsssfpqfksdevaavmkdfdepgsla
ptglhlggtkymviqgepgavirgkkgsggitvkrtgqaliigiydepltpgqcnmiver
lgdylldqgl

SCOPe Domain Coordinates for d1g5ub_:

Click to download the PDB-style file with coordinates for d1g5ub_.
(The format of our PDB-style files is described here.)

Timeline for d1g5ub_: