Lineage for d1yprb_ (1ypr B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970039Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 2970040Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 2970041Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 2970049Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55777] (2 PDB entries)
  8. 2970051Domain d1yprb_: 1ypr B: [40889]

Details for d1yprb_

PDB Entry: 1ypr (more details), 2.3 Å

PDB Description: saccharomyces cerevisiae (yeast) profilin
PDB Compounds: (B:) Profilin

SCOPe Domain Sequences for d1yprb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yprb_ d.110.1.1 (B:) Profilin (actin-binding protein) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
swqaytdnligtgkvdkaviysragdavwatsgglslqpneigeivqgfdnpaglqsngl
hiqgqkfmllraddrsiygrhdaegvvcvrtkqtviiahypptvqageatkiveqladyl
igvqy

SCOPe Domain Coordinates for d1yprb_:

Click to download the PDB-style file with coordinates for d1yprb_.
(The format of our PDB-style files is described here.)

Timeline for d1yprb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ypra_