SCOPe 2.07: Domain d1yprb_: 1ypr B:

Lineage for d1yprb_ (1ypr B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
   automatically mapped to Pfam PF00235

6. Protein Profilin (actin-binding protein) [55772] (8 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55777] (2 PDB entries)

8. Domain d1yprb_: 1ypr B: [40889]

Details for d1yprb_

PDB Entry: 1ypr, 2.3 Å

PDB Description: saccharomyces cerevisiae (yeast) profilin

PDB Compounds: (B:) Profilin

SCOPe Domain Sequences for d1yprb_:

Sequence; same for both SEQRES and ATOM records:

>d1yprb_ d.110.1.1 (B:) Profilin (actin-binding protein) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
swqaytdnligtgkvdkaviysragdavwatsgglslqpneigeivqgfdnpaglqsngl
hiqgqkfmllraddrsiygrhdaegvvcvrtkqtviiahypptvqageatkiveqladyl
igvqy

Timeline for d1yprb_:

• d1yprb_ first appeared (with stable ids) in SCOP 1.55
  
• d1yprb_ appears in SCOPe 2.06
  
• d1yprb_ appears in the current release, SCOPe 2.08