| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily) |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) ![]() |
| Family d.109.1.1: Gelsolin-like [55754] (3 proteins) |
| Protein Gelsolin [55759] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55761] (10 PDB entries) |
| Domain d1yvng_: 1yvn G: [40849] Other proteins in same PDB: d1yvna1, d1yvna2 |
PDB Entry: 1yvn (more details), 2.1 Å
SCOP Domain Sequences for d1yvng_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvng_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens)}
mvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd
lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
vasgf
Timeline for d1yvng_: