Lineage for d1yvng_ (1yvn G:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35145Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 35146Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 35147Family d.109.1.1: Gelsolin-like [55754] (3 proteins)
  6. 35148Protein Gelsolin [55759] (2 species)
  7. 35162Species Human (Homo sapiens) [TaxId:9606] [55761] (9 PDB entries)
  8. 35166Domain d1yvng_: 1yvn G: [40849]
    Other proteins in same PDB: d1yvna1, d1yvna2

Details for d1yvng_

PDB Entry: 1yvn (more details), 2.1 Å

PDB Description: the yeast actin val 159 asn mutant complex with human gelsolin segment 1.

SCOP Domain Sequences for d1yvng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvng_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens)}
mvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd
lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
vasgf

SCOP Domain Coordinates for d1yvng_:

Click to download the PDB-style file with coordinates for d1yvng_.
(The format of our PDB-style files is described here.)

Timeline for d1yvng_: