Lineage for d1yvna2 (1yvn A:147-375)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 71789Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 71790Family c.55.1.1: Actin/HSP70 [53068] (4 proteins)
  6. 71791Protein Actin [53073] (5 species)
  7. 71792Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53077] (2 PDB entries)
  8. 71796Domain d1yvna2: 1yvn A:147-375 [33452]
    Other proteins in same PDB: d1yvng_

Details for d1yvna2

PDB Entry: 1yvn (more details), 2.1 Å

PDB Description: the yeast actin val 159 asn mutant complex with human gelsolin segment 1.

SCOP Domain Sequences for d1yvna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvna2 c.55.1.1 (A:147-375) Actin {Baker's yeast (Saccharomyces cerevisiae)}
rttgivldsgdgnthvvpiyagfslphailridlagrdltdylmkilsergysfsttaer
eivrdikeklcyvaldfeqemqtaaqsssieksyelpdgqvitignerfrapealfhpsv
lglesagidqttynsimkcdvdvrkelygnivmsggttmfpgiaermqkeitalapssmk
vkiiapperkysvwiggsilaslttfqqmwiskqeydesgpsivhhkcf

SCOP Domain Coordinates for d1yvna2:

Click to download the PDB-style file with coordinates for d1yvna2.
(The format of our PDB-style files is described here.)

Timeline for d1yvna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yvna1
View in 3D
Domains from other chains:
(mouse over for more information)
d1yvng_