SCOP 1.59: Domain d1c0gs_: 1c0g S:

Lineage for d1c0gs_ (1c0g S:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families)

5. Family d.109.1.1: Gelsolin-like [55754] (3 proteins)

6. Protein Gelsolin [55759] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (11 PDB entries)

8. Domain d1c0gs_: 1c0g S: [40848]
   Other proteins in same PDB: d1c0ga1, d1c0ga2

Details for d1c0gs_

PDB Entry: 1c0g, 2 Å

PDB Description: crystal structure of 1:1 complex between gelsolin segment 1 and a dictyostelium/tetrahymena chimera actin (mutant 228: q228k/t229a/a230y/e360h)

SCOP Domain Sequences for d1c0gs_:

Sequence; same for both SEQRES and ATOM records:

>d1c0gs_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens)}
mgsvvehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlq
ydlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykk
ggvasgf

Timeline for d1c0gs_:

• d1c0gs_ first appeared (with stable ids) in SCOP 1.55
  
• d1c0gs_ appears in SCOP 1.57
  
• d1c0gs_ appears in SCOP 1.61
  
• d1c0gs_ appears in the current release, SCOPe 2.08