Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
Protein Gelsolin [55759] (2 species) consists of six similar domains |
Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries) Uniprot P20065 55-179 |
Domain d1c0gs_: 1c0g S: [40848] Other proteins in same PDB: d1c0ga1, d1c0ga2 domain 1 complexed with atp, ca; mutant |
PDB Entry: 1c0g (more details), 2 Å
SCOPe Domain Sequences for d1c0gs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c0gs_ d.109.1.1 (S:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} mgsvvehpeflkagkepglqiwrvekfdlvpvptclygdfftgdayvilktvqlrngnlq ydlhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykk ggvasgf
Timeline for d1c0gs_: