Lineage for d1d0nb5 (1d0n B:533-628)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665022Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1665023Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1665024Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 1665025Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 1665026Species Horse (Equus caballus) [TaxId:9796] [55760] (2 PDB entries)
    Uniprot Q28372 1-346
  8. 1665037Domain d1d0nb5: 1d0n B:533-628 [40844]

Details for d1d0nb5

PDB Entry: 1d0n (more details), 2.5 Å

PDB Description: the crystal structure of calcium-free equine plasma gelsolin.
PDB Compounds: (B:) horse plasma gelsolin

SCOPe Domain Sequences for d1d0nb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0nb5 d.109.1.1 (B:533-628) Gelsolin {Horse (Equus caballus) [TaxId: 9796]}
pastrlfqvrasssgatraveiipkagalnsndafvlktpsaaylwvgagaseaektgaq
ellrvlraqpvqvaegsepdsfwealggkatyrtsp

SCOPe Domain Coordinates for d1d0nb5:

Click to download the PDB-style file with coordinates for d1d0nb5.
(The format of our PDB-style files is described here.)

Timeline for d1d0nb5: