Lineage for d1nmtc2 (1nmt C:225-451)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261001Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 261002Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (4 families) (S)
  5. 261088Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 261089Protein N-myristoyl transferase, NMT [55749] (2 species)
  7. 261099Species Yeast (Candida albicans) [TaxId:5476] [55751] (3 PDB entries)
  8. 261109Domain d1nmtc2: 1nmt C:225-451 [40828]
    complexed with gol

Details for d1nmtc2

PDB Entry: 1nmt (more details), 2.45 Å

PDB Description: n-myristoyl transferase from candida albicans at 2.45 a

SCOP Domain Sequences for d1nmtc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmtc2 d.108.1.2 (C:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans)}
yqhrpinwsklhdvgfshlppnqtkssmvasytlpnnpklkglrpmtgkdvstvlsllyk
yqerfdivqlfteeefkhwmlghdensdsnvvksyvvedengiitdyfsyyllpftvldn
aqhdelgiaylfyyasdsfekpnykkrlnelitdalitskkfgvdvfncltcqdntyflk
dckfgsgdgflnyylfnyrtfpmdggidkktkevvedqtsgigvvll

SCOP Domain Coordinates for d1nmtc2:

Click to download the PDB-style file with coordinates for d1nmtc2.
(The format of our PDB-style files is described here.)

Timeline for d1nmtc2: