Lineage for d1qsna_ (1qsn A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664278Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1664312Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (3 species)
  7. 1664318Species Tetrahymena thermophila [TaxId:5911] [55739] (9 PDB entries)
    Uniprot Q27198 49-209
  8. 1664323Domain d1qsna_: 1qsn A: [40806]
    complex with coenzyme A and histone H3 peptide
    complexed with coa

Details for d1qsna_

PDB Entry: 1qsn (more details), 2.2 Å

PDB Description: crystal structure of tetrahymena gcn5 with bound coenzyme a and histone h3 peptide
PDB Compounds: (A:) tgcn5 histone acetyl transferase

SCOPe Domain Sequences for d1qsna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsna_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]}
ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr

SCOPe Domain Coordinates for d1qsna_:

Click to download the PDB-style file with coordinates for d1qsna_.
(The format of our PDB-style files is described here.)

Timeline for d1qsna_: