Lineage for d1qsna_ (1qsn A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35089Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 35090Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 35091Family d.108.1.1: N-acetyl transferase, NAT [55730] (8 proteins)
  6. 35099Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (2 species)
  7. 35103Species Tetrahymena thermophila [TaxId:5911] [55739] (4 PDB entries)
  8. 35106Domain d1qsna_: 1qsn A: [40806]

Details for d1qsna_

PDB Entry: 1qsn (more details), 2.2 Å

PDB Description: crystal structure of tetrahymena gcn5 with bound coenzyme a and histone h3 peptide

SCOP Domain Sequences for d1qsna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsna_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila}
ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr

SCOP Domain Coordinates for d1qsna_:

Click to download the PDB-style file with coordinates for d1qsna_.
(The format of our PDB-style files is described here.)

Timeline for d1qsna_: