Lineage for d1b9ka2 (1b9k A:825-938)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968220Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
    beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet
  4. 2968221Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) (S)
  5. 2968222Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)
  6. 2968223Protein Alpa-adaptin AP2, C-terminal subdomain [55713] (1 species)
  7. 2968224Species Mouse (Mus musculus) [TaxId:10090] [55714] (10 PDB entries)
    Uniprot P17427 694-938 # 98% sequence identity
  8. 2968229Domain d1b9ka2: 1b9k A:825-938 [40791]
    Other proteins in same PDB: d1b9ka1
    CASP3

Details for d1b9ka2

PDB Entry: 1b9k (more details), 1.9 Å

PDB Description: alpha-adaptin appendage domain, from clathrin adaptor ap2
PDB Compounds: (A:) protein (alpha-adaptin appendage domain)

SCOPe Domain Sequences for d1b9ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9ka2 d.105.1.1 (A:825-938) Alpa-adaptin AP2, C-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]}
ffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevdpnp
anfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf

SCOPe Domain Coordinates for d1b9ka2:

Click to download the PDB-style file with coordinates for d1b9ka2.
(The format of our PDB-style files is described here.)

Timeline for d1b9ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b9ka1