PDB entry 1b9k

View 1b9k on RCSB PDB site
Description: alpha-adaptin appendage domain, from clathrin adaptor ap2
Class: endocytosis/exocytosis
Keywords: endocytosis, adaptor, endocytosis/exocytosis complex
Deposited on 1999-02-11, released 1999-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.172
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alpha-adaptin appendage domain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b9ka1, d1b9ka2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b9kA (A:)
    sednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqflnftptlicad
    dlqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryggtfqnvsvklpi
    tlnkffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleev
    dpnpanfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b9kA (A:)
    ednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqflnftptlicadd
    lqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryggtfqnvsvklpit
    lnkffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevd
    pnpanfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf