Lineage for d1b9ka1 (1b9k A:702-824)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764533Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) (S)
    contains an additional N-terminal strand
  5. 2764534Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins)
    ear domain consists of two different subdomains
    automatically mapped to Pfam PF02883
  6. 2764535Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species)
  7. 2764536Species Mouse (Mus musculus) [TaxId:10090] [49351] (10 PDB entries)
    Uniprot P17427 694-938 # 98% sequence identity
  8. 2764541Domain d1b9ka1: 1b9k A:702-824 [22315]
    Other proteins in same PDB: d1b9ka2
    CASP3

Details for d1b9ka1

PDB Entry: 1b9k (more details), 1.9 Å

PDB Description: alpha-adaptin appendage domain, from clathrin adaptor ap2
PDB Compounds: (A:) protein (alpha-adaptin appendage domain)

SCOPe Domain Sequences for d1b9ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9ka1 b.1.10.1 (A:702-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]}
ednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqflnftptlicadd
lqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryggtfqnvsvklpit
lnk

SCOPe Domain Coordinates for d1b9ka1:

Click to download the PDB-style file with coordinates for d1b9ka1.
(The format of our PDB-style files is described here.)

Timeline for d1b9ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b9ka2