Lineage for d6zp8v_ (6zp8 V:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994120Domain d6zp8v_: 6zp8 V: [407675]
    Other proteins in same PDB: d6zp8c2, d6zp8e_, d6zp8g_, d6zp8i_, d6zp8j_, d6zp8k_, d6zp8l_, d6zp8n_, d6zp8o_, d6zp8q2, d6zp8s_, d6zp8u_, d6zp8w_, d6zp8x_, d6zp8y_, d6zp8z_
    automated match to d5fg9h_
    complexed with cl, mg, qoe

Details for d6zp8v_

PDB Entry: 6zp8 (more details), 3 Å

PDB Description: yeast 20s proteasome in complex with glidobactin-like natural product hb335
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d6zp8v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zp8v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d6zp8v_:

Click to download the PDB-style file with coordinates for d6zp8v_.
(The format of our PDB-style files is described here.)

Timeline for d6zp8v_: