Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d6zp8t_: 6zp8 T: [407674] Other proteins in same PDB: d6zp8c2, d6zp8e_, d6zp8g_, d6zp8i_, d6zp8j_, d6zp8k_, d6zp8l_, d6zp8n_, d6zp8o_, d6zp8q2, d6zp8s_, d6zp8u_, d6zp8w_, d6zp8x_, d6zp8y_, d6zp8z_ automated match to d4g4sg_ complexed with cl, mg, qoe |
PDB Entry: 6zp8 (more details), 3 Å
SCOPe Domain Sequences for d6zp8t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zp8t_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk ein
Timeline for d6zp8t_:
View in 3D Domains from other chains: (mouse over for more information) d6zp8a_, d6zp8b_, d6zp8c1, d6zp8c2, d6zp8d_, d6zp8e_, d6zp8f_, d6zp8g_, d6zp8h_, d6zp8i_, d6zp8j_, d6zp8k_, d6zp8l_, d6zp8m_, d6zp8n_, d6zp8o_, d6zp8p_, d6zp8q1, d6zp8q2, d6zp8r_, d6zp8s_, d6zp8u_, d6zp8v_, d6zp8w_, d6zp8x_, d6zp8y_, d6zp8z_ |