Lineage for d1atia2 (1ati A:1-394)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. Protein Glycyl-tRNA synthetase (GlyRS) [55692] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [55693] (3 PDB entries)
  8. Domain d1atia2: 1ati A:1-394 [40745]
    Other proteins in same PDB: d1atia1, d1atib1
    has additional insertions and/or extensions that are not grouped together

Details for d1atia2

PDB Entry: 1ati (more details), 2.75 Å

PDB Description: crystal structure of glycyl-trna synthetase from thermus thermophilus
PDB Compounds: (A:) GLYCYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1atia2:

Sequence, based on SEQRES records: (download)

>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]}
aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
egldasvlthrlvlhysgheatfadpmvdnritkkryrldhllkeqpeevlkrlyramev
eeenlhalvqammqaperaggamtaagvldpasgepgdwtppryfnmmfqdlrgprggrg
llaylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmei
eyfvrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfph
gslelegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviep
sagvdrgvlallaeaftreelpngeerivlklkp

Sequence, based on observed residues (ATOM records): (download)

>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]}
aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
egldasvlthrlvlhysgheatfadpmvdnwtppryfnmmfqdlrgprggrgllaylrpe
taqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyfvrpge
deywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgslelegi
aqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsagvdrgv
lallaeaftreelpngeerivlklkp

SCOPe Domain Coordinates for d1atia2 are not available.

Timeline for d1atia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1atia1
View in 3D
Domains from other chains:
(mouse over for more information)
d1atib1, d1atib2