PDB entry 1ati

View 1ati on RCSB PDB site
Description: crystal structure of glycyl-tRNA synthetase from thermus thermophilus
Class: protein biosynthesis
Keywords: protein biosynthesis, ligase, synthetase, aminoacyl-tRNA synthetase
Deposited on 1996-04-23, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.227
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GLYCYL-tRNA SYNTHETASE
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1atia1, d1atia2
  • Chain 'B':
    Compound: GLYCYL-tRNA SYNTHETASE
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1atib1, d1atib2
  • Chain 'C':
    Compound: GLYCYL-tRNA SYNTHETASE
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ATI (0-36)
  • Chain 'D':
    Compound: GLYCYL-tRNA SYNTHETASE
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ATI (0-15)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1atiA (A:)
    aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
    egldasvlthrlvlhysgheatfadpmvdnritkkryrldhllkeqpeevlkrlyramev
    eeenlhalvqammqaperaggamtaagvldpasgepgdwtppryfnmmfqdlrgprggrg
    llaylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmei
    eyfvrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfph
    gslelegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviep
    sagvdrgvlallaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrl
    karllalglgrvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvr
    drdtmeqirlhvdelegflrerlrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1atiA (A:)
    aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
    egldasvlthrlvlhysgheatfadpmvdnwtppryfnmmfqdlrgprggrgllaylrpe
    taqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyfvrpge
    deywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgslelegi
    aqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsagvdrgv
    lallaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrlkarllalg
    lgrvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvrdrdtmeqi
    rlhvdelegflrerlrw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1atiB (B:)
    aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
    egldasvlthrlvlhysgheatfadpmvdnritkkryrldhllkeqpeevlkrlyramev
    eeenlhalvqammqaperaggamtaagvldpasgepgdwtppryfnmmfqdlrgprggrg
    llaylrpetaqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmei
    eyfvrpgedeywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfph
    gslelegiaqrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviep
    sagvdrgvlallaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrl
    karllalglgrvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvr
    drdtmeqirlhvdelegflrerlrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1atiB (B:)
    aassldelvalckrrgfifqsseiygglqgvydygplgvelknnlkqawwrrnvyerddm
    egldasvlthrlvlhysgheatfadpmvdwtppryfnmmfqdlrgprggrgllaylrpet
    aqgifvnfknvldatsrklgfgiaqigkafrneitprnfifrvrefeqmeieyfvrpged
    eywhrywveerlkwwqemglsrenlvpyqqppessahyakatvdilyrfphgslelegia
    qrtdfdlgshtkdqealgitarvlrnehstqrlayrdpetgkwfvpyviepsagvdrgvl
    allaeaftreelpngeerivlklkpqlapikvaviplvknrpeiteyakrlkarllalgl
    grvlyedtgnigkayrrhdevgtpfavtvdydtigqskdgttrlkdtvtvrdrdtmeqir
    lhvdelegflrerlrw
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.