Lineage for d1serb2 (1ser B:611-921)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426347Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1426348Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1426349Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1426524Protein Seryl-tRNA synthetase (SerRS) [55683] (1 species)
  7. 1426525Species Thermus thermophilus, strain hb27 [TaxId:274] [55684] (4 PDB entries)
  8. 1426533Domain d1serb2: 1ser B:611-921 [40713]
    Other proteins in same PDB: d1sera1, d1serb1
    protein/RNA complex

Details for d1serb2

PDB Entry: 1ser (more details), 2.9 Å

PDB Description: the 2.9 angstroms crystal structure of t. thermophilus seryl-trna synthetase complexed with trna ser
PDB Compounds: (B:) protein (seryl-tRNA synthetase (e.c.6.1.1.11))

SCOPe Domain Sequences for d1serb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1serb2 d.104.1.1 (B:611-921) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]}
vggeeanreikrvggppefsfppldhvalmekngwweprisqvsgsrsyalkgdlalyel
allrfamdfmarrgflpmtlpsyarekaflgtghfpayrdqvwaiaetdlyltgtaevvl
nalhsgeilpyealplryagyapafrseagsfgkdvrglmrvhqfhkveqyvlteaslea
sdrafqellenaeeilrllelpyrlvevatgdmgpgkwrqvdievylpsegryrethscs
alldwqarranlryrdpegrvryaytlnntalatprilamllenhqlqdgrvrvpqalip
ymgkevlepcg

SCOPe Domain Coordinates for d1serb2:

Click to download the PDB-style file with coordinates for d1serb2.
(The format of our PDB-style files is described here.)

Timeline for d1serb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1serb1