Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein Seryl-tRNA synthetase (SerRS) [55683] (1 species) |
Species Thermus thermophilus, strain hb27 [TaxId:274] [55684] (4 PDB entries) |
Domain d1serb2: 1ser B:611-921 [40713] Other proteins in same PDB: d1sera1, d1serb1 protein/RNA complex |
PDB Entry: 1ser (more details), 2.9 Å
SCOPe Domain Sequences for d1serb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1serb2 d.104.1.1 (B:611-921) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} vggeeanreikrvggppefsfppldhvalmekngwweprisqvsgsrsyalkgdlalyel allrfamdfmarrgflpmtlpsyarekaflgtghfpayrdqvwaiaetdlyltgtaevvl nalhsgeilpyealplryagyapafrseagsfgkdvrglmrvhqfhkveqyvlteaslea sdrafqellenaeeilrllelpyrlvevatgdmgpgkwrqvdievylpsegryrethscs alldwqarranlryrdpegrvryaytlnntalatprilamllenhqlqdgrvrvpqalip ymgkevlepcg
Timeline for d1serb2: