SCOPe 2.08: Domain d1serb2: 1ser B:611-921

Lineage for d1serb2 (1ser B:611-921)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Seryl-tRNA synthetase (SerRS) [55683] (1 species)

7. Species Thermus thermophilus, strain hb27 [TaxId:274] [55684] (4 PDB entries)

8. Domain d1serb2: 1ser B:611-921 [40713]
   Other proteins in same PDB: d1sera1, d1serb1
   protein/RNA complex
   has additional insertions and/or extensions that are not grouped together

Details for d1serb2

PDB Entry: 1ser, 2.9 Å

PDB Description: the 2.9 angstroms crystal structure of t. thermophilus seryl-trna synthetase complexed with trna ser

PDB Compounds: (B:) protein (seryl-tRNA synthetase (e.c.6.1.1.11))

SCOPe Domain Sequences for d1serb2:

Sequence; same for both SEQRES and ATOM records:

>d1serb2 d.104.1.1 (B:611-921) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]}
vggeeanreikrvggppefsfppldhvalmekngwweprisqvsgsrsyalkgdlalyel
allrfamdfmarrgflpmtlpsyarekaflgtghfpayrdqvwaiaetdlyltgtaevvl
nalhsgeilpyealplryagyapafrseagsfgkdvrglmrvhqfhkveqyvlteaslea
sdrafqellenaeeilrllelpyrlvevatgdmgpgkwrqvdievylpsegryrethscs
alldwqarranlryrdpegrvryaytlnntalatprilamllenhqlqdgrvrvpqalip
ymgkevlepcg

Timeline for d1serb2:

• d1serb2 first appeared (with stable ids) in SCOP 1.55
  
• d1serb2 appears in SCOPe 2.07