SCOP 1.67: Domain d1efnd_: 1efn D:

Lineage for d1efnd_ (1efn D:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
   alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.102.1: Regulatory factor Nef [55671] (1 family)

5. Family d.102.1.1: Regulatory factor Nef [55672] (1 protein)

6. Protein Regulatory factor Nef [55673] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [55674] (4 PDB entries)

8. Domain d1efnd_: 1efn D: [40700]
   Other proteins in same PDB: d1efna_, d1efnc_
   complexed with pbm; mutant

Details for d1efnd_

PDB Entry: 1efn, 2.5 Å

PDB Description: hiv-1 nef protein in complex with r96i mutant fyn sh3 domain

SCOP Domain Sequences for d1efnd_:

Sequence, based on SEQRES records:

>d1efnd_ d.102.1.1 (D:) Regulatory factor Nef {Human immunodeficiency virus type 1}
rpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpg
pgvrypltfgwcyklvpvepdkveeankgentsllhpvslhgmddperevlewrfdsrla
fhhvarelhpeyf

Sequence, based on observed residues (ATOM records):

>d1efnd_ d.102.1.1 (D:) Regulatory factor Nef {Human immunodeficiency virus type 1}
rpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpg
pgvrypltfgwcyklvpvrevlewrfdsrlafhhvarelhpeyf

Timeline for d1efnd_:

• d1efnd_ first appeared (with stable ids) in SCOP 1.55
  
• d1efnd_ appears in SCOP 1.65
  
• d1efnd_ appears in SCOP 1.69
  
• d1efnd_ appears in the current release, SCOPe 2.08