SCOP 1.67: Domain d1efna_: 1efn A:

Lineage for d1efna_ (1efn A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (33 proteins)

6. Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50049] (10 PDB entries)

8. Domain d1efna_: 1efn A: [24465]
   Other proteins in same PDB: d1efnb_, d1efnd_

Details for d1efna_

PDB Entry: 1efn, 2.5 Å

PDB Description: hiv-1 nef protein in complex with r96i mutant fyn sh3 domain

SCOP Domain Sequences for d1efna_:

Sequence; same for both SEQRES and ATOM records:

>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens)}
alfvalydyeaiteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapv

Timeline for d1efna_:

• d1efna_ first appeared (with stable ids) in SCOP 1.55
  
• d1efna_ appears in SCOP 1.65
  
• d1efna_ appears in SCOP 1.69
  
• d1efna_ appears in the current release, SCOPe 2.08