Lineage for d1efna_ (1efn A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13133Protein Fyn proto-oncogene tyrosine kinase, SH3 domain [50048] (1 species)
  7. 13134Species Human (Homo sapiens) [TaxId:9606] [50049] (8 PDB entries)
  8. 13138Domain d1efna_: 1efn A: [24465]
    Other proteins in same PDB: d1efnb_, d1efnd_

Details for d1efna_

PDB Entry: 1efn (more details), 2.5 Å

PDB Description: hiv-1 nef protein in complex with r96i mutant fyn sh3 domain

SCOP Domain Sequences for d1efna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens)}
alfvalydyeaiteddlsfhkgekfqilnssegdwwearslttgetgyipsnyvapv

SCOP Domain Coordinates for d1efna_:

Click to download the PDB-style file with coordinates for d1efna_.
(The format of our PDB-style files is described here.)

Timeline for d1efna_: