Lineage for d1efnd_ (1efn D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532501Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
    alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha
  4. 2532502Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) (S)
  5. 2532503Family d.102.1.1: Regulatory factor Nef [55672] (2 proteins)
    automatically mapped to Pfam PF00469
  6. 2532504Protein Regulatory factor Nef [55673] (1 species)
  7. 2532505Species Human immunodeficiency virus type 1 [TaxId:11676] [55674] (4 PDB entries)
  8. 2532507Domain d1efnd_: 1efn D: [40700]
    Other proteins in same PDB: d1efna_, d1efnc_
    complexed with pbm; mutant

Details for d1efnd_

PDB Entry: 1efn (more details), 2.5 Å

PDB Description: hiv-1 nef protein in complex with r96i mutant fyn sh3 domain
PDB Compounds: (D:) hiv-1 nef protein

SCOPe Domain Sequences for d1efnd_:

Sequence, based on SEQRES records: (download)

>d1efnd_ d.102.1.1 (D:) Regulatory factor Nef {Human immunodeficiency virus type 1 [TaxId: 11676]}
rpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpg
pgvrypltfgwcyklvpvepdkveeankgentsllhpvslhgmddperevlewrfdsrla
fhhvarelhpeyf

Sequence, based on observed residues (ATOM records): (download)

>d1efnd_ d.102.1.1 (D:) Regulatory factor Nef {Human immunodeficiency virus type 1 [TaxId: 11676]}
rpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpg
pgvrypltfgwcyklvpvrevlewrfdsrlafhhvarelhpeyf

SCOPe Domain Coordinates for d1efnd_:

Click to download the PDB-style file with coordinates for d1efnd_.
(The format of our PDB-style files is described here.)

Timeline for d1efnd_: