Lineage for d1cksb_ (1cks B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260732Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 260733Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 260734Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins)
  6. 260747Protein CksHs2 [55643] (1 species)
  7. 260748Species Human (Homo sapiens) [TaxId:9606] [55644] (1 PDB entry)
  8. 260750Domain d1cksb_: 1cks B: [40684]

Details for d1cksb_

PDB Entry: 1cks (more details), 2.1 Å

PDB Description: human ckshs2 atomic structure: a role for its hexameric assembly in cell cycle control

SCOP Domain Sequences for d1cksb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cksb_ d.97.1.1 (B:) CksHs2 {Human (Homo sapiens)}
ahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymihe
pephillfrrplpkdqqk

SCOP Domain Coordinates for d1cksb_:

Click to download the PDB-style file with coordinates for d1cksb_.
(The format of our PDB-style files is described here.)

Timeline for d1cksb_: