Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) |
Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins) |
Protein CksHs2 [55643] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55644] (1 PDB entry) |
Domain d1cksb_: 1cks B: [40684] |
PDB Entry: 1cks (more details), 2.1 Å
SCOP Domain Sequences for d1cksb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cksb_ d.97.1.1 (B:) CksHs2 {Human (Homo sapiens)} ahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymihe pephillfrrplpkdqqk
Timeline for d1cksb_: