| Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
| Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) ![]() |
| Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins) |
| Protein suc1 [55639] (1 species) |
| Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [55640] (2 PDB entries) |
| Domain d1sced_: 1sce D: [40679] |
PDB Entry: 1sce (more details), 2.2 Å
SCOP Domain Sequences for d1sced_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sced_ d.97.1.1 (D:) suc1 {Fission yeast (Schizosaccharomyces pombe)}
ksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetgt
lrilqeeewrglgitqslgwemyevhvpephillfkrekdyqm
Timeline for d1sced_: