SCOPe 2.06: Domain d1scec_: 1sce C:

Lineage for d1scec_ (1sce C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
   can form strand-exchange dimers

4. Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family)

5. Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)

6. Protein suc1 [55639] (1 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [55640] (2 PDB entries)
   in hexamer, the beta-sheets of three dimers form a barrel, closed: n=12, S=12

8. Domain d1scec_: 1sce C: [40678]
   complexed with cl

Details for d1scec_

PDB Entry: 1sce, 2.2 Å

PDB Description: crystal structure of the cell cycle regulatory protein suc1 reveals a novel beta-hinge conformational switch

PDB Compounds: (C:) suc1

SCOPe Domain Sequences for d1scec_:

Sequence; same for both SEQRES and ATOM records:

>d1scec_ d.97.1.1 (C:) suc1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
sksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetg
tlrilqeeewrglgitqslgwemyevhvpephillfkrekdyqmksqqrgg

Timeline for d1scec_:

• d1scec_ first appeared (with stable ids) in SCOP 1.55
  
• d1scec_ appears in SCOPe 2.05
  
• d1scec_ appears in SCOPe 2.07
  
• d1scec_ appears in the current release, SCOPe 2.08