Lineage for d1sceb_ (1sce B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195286Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
  4. 195287Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 195288Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins)
  6. 195306Protein suc1 [55639] (1 species)
  7. 195307Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [55640] (2 PDB entries)
  8. 195310Domain d1sceb_: 1sce B: [40677]

Details for d1sceb_

PDB Entry: 1sce (more details), 2.2 Å

PDB Description: crystal structure of the cell cycle regulatory protein suc1 reveals a novel beta-hinge conformational switch

SCOP Domain Sequences for d1sceb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sceb_ d.97.1.1 (B:) suc1 {Fission yeast (Schizosaccharomyces pombe)}
vprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetgtlri
lqeeewrglgitqslgwemyevhvpephillfkrekd

SCOP Domain Coordinates for d1sceb_:

Click to download the PDB-style file with coordinates for d1sceb_.
(The format of our PDB-style files is described here.)

Timeline for d1sceb_: