Lineage for d7nn1d_ (7nn1 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505177Species Mycobacterium tuberculosis [TaxId:83332] [187938] (11 PDB entries)
  8. 2505185Domain d7nn1d_: 7nn1 D: [406294]
    automated match to d1sffa_
    complexed with llp, no3

Details for d7nn1d_

PDB Entry: 7nn1 (more details), 1.54 Å

PDB Description: crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate
PDB Compounds: (D:) Acetylornithine aminotransferase

SCOPe Domain Sequences for d7nn1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nn1d_ c.67.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ttatmrqrwqavmmnnygtppialasgdgavvtdvdgrtyidllggiavnvlghrhpavi
eavtrqmstlghtsnlyatepgialaeelvallgadqrtrvffcnsgaeaneaafklsrl
tgrtklvaahdafhgrtmgslaltgqpakqtpfaplpgdvthvgygdvdalaaavddhta
avflepimgesgvvvppagylaaarditarrgallvldevqtgmgrtgaffahqhdgitp
dvvtlakglggglpigaclavgpaaelltpglhgstfggnpvcaaaalavlrvlasdglv
rraevlgkslrhgiealghplidhvrgrglllgialtaphakdaeatardagylvnaaap
dvirlappliiaeaqldgfvaalpaildrav

SCOPe Domain Coordinates for d7nn1d_:

Click to download the PDB-style file with coordinates for d7nn1d_.
(The format of our PDB-style files is described here.)

Timeline for d7nn1d_: