Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [187938] (11 PDB entries) |
Domain d7nn1d_: 7nn1 D: [406294] automated match to d1sffa_ complexed with llp, no3 |
PDB Entry: 7nn1 (more details), 1.54 Å
SCOPe Domain Sequences for d7nn1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nn1d_ c.67.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ttatmrqrwqavmmnnygtppialasgdgavvtdvdgrtyidllggiavnvlghrhpavi eavtrqmstlghtsnlyatepgialaeelvallgadqrtrvffcnsgaeaneaafklsrl tgrtklvaahdafhgrtmgslaltgqpakqtpfaplpgdvthvgygdvdalaaavddhta avflepimgesgvvvppagylaaarditarrgallvldevqtgmgrtgaffahqhdgitp dvvtlakglggglpigaclavgpaaelltpglhgstfggnpvcaaaalavlrvlasdglv rraevlgkslrhgiealghplidhvrgrglllgialtaphakdaeatardagylvnaaap dvirlappliiaeaqldgfvaalpaildrav
Timeline for d7nn1d_: