Lineage for d1fbxl_ (1fbx L:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 260606Fold d.96: T-fold [55619] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 260607Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 260608Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)
  6. 260609Protein GTP cyclohydrolase I [55622] (3 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 260610Species Escherichia coli [TaxId:562] [55623] (4 PDB entries)
  8. 260672Domain d1fbxl_: 1fbx L: [40628]

Details for d1fbxl_

PDB Entry: 1fbx (more details), 2.8 Å

PDB Description: crystal structure of zinc-containing e.coli gtp cyclohydrolase i

SCOP Domain Sequences for d1fbxl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbxl_ d.96.1.1 (L:) GTP cyclohydrolase I {Escherichia coli}
pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstcehhfvtidgk
atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
cvkargirdatsattttslgglfkssqntrheflravrhhn

SCOP Domain Coordinates for d1fbxl_:

Click to download the PDB-style file with coordinates for d1fbxl_.
(The format of our PDB-style files is described here.)

Timeline for d1fbxl_: