Lineage for d7nnya1 (7nny A:2-143)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2514304Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2514305Protein automated matches [226938] (26 species)
    not a true protein
  7. 2514435Species Mycobacterium tuberculosis [TaxId:83332] [225288] (11 PDB entries)
  8. 2514448Domain d7nnya1: 7nny A:2-143 [405847]
    Other proteins in same PDB: d7nnya3, d7nnyb3, d7nnyc3, d7nnyd3, d7nnye3, d7nnyf3
    automated match to d2i6ua1
    complexed with 1np, po4

Details for d7nnya1

PDB Entry: 7nny (more details), 1.57 Å

PDB Description: crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d7nnya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nnya1 c.78.1.0 (A:2-143) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
irhflrdddlspaeqaevlelaaelkkdpvsrrplqgprgvavifdknstrtrfsfelgi
aqlgghavvvdsgstqlgrdetlqdtakvlsryvdaivwrtfgqerldamasvatvpvin
alsdefhpcqvladlqtiaerk

SCOPe Domain Coordinates for d7nnya1:

Click to download the PDB-style file with coordinates for d7nnya1.
(The format of our PDB-style files is described here.)

Timeline for d7nnya1: