Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (26 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [225288] (11 PDB entries) |
Domain d7nnyd1: 7nny D:2-143 [405820] Other proteins in same PDB: d7nnya3, d7nnyb3, d7nnyc3, d7nnyd3, d7nnye3, d7nnyf3 automated match to d2i6ua1 complexed with 1np, po4 |
PDB Entry: 7nny (more details), 1.57 Å
SCOPe Domain Sequences for d7nnyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nnyd1 c.78.1.0 (D:2-143) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} irhflrdddlspaeqaevlelaaelkkdpvsrrplqgprgvavifdknstrtrfsfelgi aqlgghavvvdsgstqlgrdetlqdtakvlsryvdaivwrtfgqerldamasvatvpvin alsdefhpcqvladlqtiaerk
Timeline for d7nnyd1: