Lineage for d7nera_ (7ner A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783262Species Chicken (Gallus gallus) [TaxId:9031] [187080] (10 PDB entries)
  8. 2783267Domain d7nera_: 7ner A: [405803]
    automated match to d3ua6b_
    complexed with pg4, so4; mutant

Details for d7nera_

PDB Entry: 7ner (more details), 1.55 Å

PDB Description: crystal structure of the v-src sh3 domain q128r mutant
PDB Compounds: (A:) v-Src SH3 domain

SCOPe Domain Sequences for d7nera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nera_ b.34.2.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ggvttfvalydyeswietdlsfkkgerlqivnntegnwwlahsvttgrtgyipsnyvaps

SCOPe Domain Coordinates for d7nera_:

Click to download the PDB-style file with coordinates for d7nera_.
(The format of our PDB-style files is described here.)

Timeline for d7nera_: