SCOP 1.63: Domain d3ezbb_: 3ezb B:

Lineage for d3ezbb_ (3ezb B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (1 family)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (6 species)

7. Species Escherichia coli [TaxId:562] [55599] (12 PDB entries)

8. Domain d3ezbb_: 3ezb B: [40556]
   Other proteins in same PDB: d3ezba1, d3ezba2

Details for d3ezbb_

PDB Entry: 3ezb

PDB Description: complex of the amino terminal domain of enzyme i and the histidine- containing phosphocarrier protein hpr from escherichia coli

SCOP Domain Sequences for d3ezbb_:

Sequence; same for both SEQRES and ATOM records:

>d3ezbb_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

Timeline for d3ezbb_:

• d3ezbb_ first appeared (with stable ids) in SCOP 1.55
  
• d3ezbb_ appears in SCOP 1.61
  
• d3ezbb_ appears in SCOP 1.65
  
• d3ezbb_ appears in the current release, SCOPe 2.08