SCOPe 2.01: Domain d1fu0b_: 1fu0 B:

Lineage for d1fu0b_ (1fu0 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)

7. Species Enterococcus faecalis [TaxId:1351] [55598] (3 PDB entries)

8. Domain d1fu0b_: 1fu0 B: [40551]
   contains phospho-serine 46

Details for d1fu0b_

PDB Entry: 1fu0, 1.9 Å

PDB Description: crystal structure analysis of the phospho-serine 46 hpr from enterococcus faecalis

PDB Compounds: (B:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d1fu0b_:

Sequence; same for both SEQRES and ATOM records:

>d1fu0b_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Enterococcus faecalis [TaxId: 1351]}
mekkefhivaetgiharpatllvqtaskfnsdinleykgksvnlksimgvmslgvgqgsd
vtitvdgadeaegmaaivetlqkegla

Timeline for d1fu0b_:

• d1fu0b_ first appeared (with stable ids) in SCOP 1.55
  
• d1fu0b_ appears in SCOP 1.75
  
• d1fu0b_ appears in SCOPe 2.02
  
• d1fu0b_ appears in the current release, SCOPe 2.08