Lineage for d7kjsb1 (7kjs B:88-227)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718557Protein automated matches [227027] (3 species)
    not a true protein
  7. 2718587Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)
  8. 2718604Domain d7kjsb1: 7kjs B:88-227 [405413]
    Other proteins in same PDB: d7kjsa_
    automated match to d1w98b2
    complexed with wg1

Details for d7kjsb1

PDB Entry: 7kjs (more details), 2.19 Å

PDB Description: crystal structure of cdk2/cyclin e in complex with pf-06873600
PDB Compounds: (B:) G1/S-specific cyclin-E1

SCOPe Domain Sequences for d7kjsb1:

Sequence, based on SEQRES records: (download)

>d7kjsb1 a.74.1.1 (B:88-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
splpvlswanreevwkimlnkektylrdqhfleqhpllqpkmrailldwlmevcevyklh
retfylaqdffdrymatqenvvktllqligisslfiaakleeiyppklhqfayvtdgacs
gdeiltmelmimkalkwrls

Sequence, based on observed residues (ATOM records): (download)

>d7kjsb1 a.74.1.1 (B:88-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
splpanreevwkimlnkektylrdqhfleqhpllqpkmrailldwlmevcevyklhretf
ylaqdffdrymatqenvvktllqligisslfiaakleeiyppklhqfayvtdgacsgdei
ltmelmimkalkwrls

SCOPe Domain Coordinates for d7kjsb1:

Click to download the PDB-style file with coordinates for d7kjsb1.
(The format of our PDB-style files is described here.)

Timeline for d7kjsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7kjsb2
View in 3D
Domains from other chains:
(mouse over for more information)
d7kjsa_