SCOPe 2.08: Domain d7dlib1: 7dli B:3-205

Lineage for d7dlib1 (7dli B:3-205)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families)
   automatically mapped to Pfam PF00875

5. Family c.28.1.0: automated matches [227292] (1 protein)
   not a true family

6. Protein automated matches [227113] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226619] (17 PDB entries)

8. Domain d7dlib1: 7dli B:3-205 [405029]
   Other proteins in same PDB: d7dlia2, d7dlib2, d7dlic2
   automated match to d4mlpa1
   complexed with edo, h8x

Details for d7dlib1

PDB Entry: 7dli, 2.2 Å

PDB Description: crystal structure of mouse cry1 in complex with kl001 compound

PDB Compounds: (B:) Cryptochrome-1

SCOPe Domain Sequences for d7dlib1:

Sequence, based on SEQRES records:

>d7dlib1 c.28.1.0 (B:3-205) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcledl
danlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagv
evivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmtpl
sddhdekygvpsleelgfdtdgl

Sequence, based on observed residues (ATOM records):

>d7dlib1 c.28.1.0 (B:3-205) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnavhwfrkglrlhdnpalkeciqgadtircvyildpvginrwrfllqcledldanlrkl
nsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagvevivris
htlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmtplsddhdek
ygvpsleelgfdtdgl

Timeline for d7dlib1:

• d7dlib1 first appeared in SCOPe 2.07