Lineage for d1cj1e_ (1cj1 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965387Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 2965388Species Human (Homo sapiens) [TaxId:9606] [55564] (38 PDB entries)
  8. 2965445Domain d1cj1e_: 1cj1 E: [40480]
    complexed with c78

Details for d1cj1e_

PDB Entry: 1cj1 (more details), 3 Å

PDB Description: growth factor receptor binding protein sh2 domain (human) complexed with a phosphotyrosyl derivative
PDB Compounds: (E:) protein (growth factor receptor-bound protein 2)

SCOPe Domain Sequences for d1cj1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cj1e_ d.93.1.1 (E:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

SCOPe Domain Coordinates for d1cj1e_:

Click to download the PDB-style file with coordinates for d1cj1e_.
(The format of our PDB-style files is described here.)

Timeline for d1cj1e_: